PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10004767m
Common NameEUTSA_v10004767mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MIKC_MADS
Protein Properties Length: 271aa    MW: 30821.6 Da    PI: 9.2436
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10004767mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.61.1e-30959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krienk+nrqvtf+kRrng+lKKA+ELSvLCdae+a++ifs++gklye++s
  Thhalv10004767m  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEIALLIFSNRGKLYEFCS 59
                     79***********************************************96 PP

2K-box86.74.5e-29821748100
            K-box   8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                      ++++++ ++ +q++ kLk+++e Lq++qRhllGe+++ + ++eL+qLe+q++ sl++iRs+K + +l+q+++l+ ke++l e+n++Lr+klee
  Thhalv10004767m  82 NQSAKDLQEKYQDYLKLKSRVEILQHSQRHLLGEEITGMGVNELEQLERQVDASLRQIRSTKARSMLDQLSDLKTKEEMLLETNRDLRRKLEE 174
                      3678899***********************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.0E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.137161IPR002100Transcription factor, MADS-box
CDDcd002658.75E-43277No hitNo description
SuperFamilySSF554553.4E-32279IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-32323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.9E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-323859IPR002100Transcription factor, MADS-box
PfamPF014864.7E-2486172IPR002487Transcription factor, K-box
PROSITE profilePS5129714.62588178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0048440Biological Processcarpel development
GO:0048441Biological Processpetal development
GO:0048442Biological Processsepal development
GO:0048443Biological Processstamen development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MGRGKVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEIALLIFSN RGKLYEFCSS  60
PSGMAKTVEK YRKHSYATMD PNQSAKDLQE KYQDYLKLKS RVEILQHSQR HLLGEEITGM  120
GVNELEQLER QVDASLRQIR STKARSMLDQ LSDLKTKEEM LLETNRDLRR KLEESDAALT  180
ESLWGDTSGA EHSQQQQQQQ QQQQQQQQQQ QQGMSSYQAN PPSQEAGFFK PLQGNVALQM  240
SHYNSAVTNA SNSATTSQNV INGFFPGWMV *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A5e-229317222101Developmental protein SEPALLATA 3
4ox0_B5e-229317222101Developmental protein SEPALLATA 3
4ox0_C5e-229317222101Developmental protein SEPALLATA 3
4ox0_D5e-229317222101Developmental protein SEPALLATA 3
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00030SELEXTransfer from AT2G03710Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankATU813690.0U81369.1 Arabidopsis thaliana MADS box protein (AGL3) mRNA, complete cds.
GenBankAY0638940.0AY063894.1 Arabidopsis thaliana putative MADS-box protein AGL3 (At2g03710) mRNA, complete cds.
GenBankAY0963860.0AY096386.1 Arabidopsis thaliana putative MADS-box protein (AGL3) (At2g03710) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006395681.10.0hypothetical protein EUTSA_v10004767mg
SwissprotP293831e-164AGL3_ARATH; Agamous-like MADS-box protein AGL3
TrEMBLV4KSI10.0V4KSI1_EUTSA; Uncharacterized protein
STRINGBra025126.1-P1e-170(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM71352440
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03710.21e-165MIKC_MADS family protein